Informacija

Koja je strukturna razlika između beta i gama globinskih lanaca Hb?

Koja je strukturna razlika između beta i gama globinskih lanaca Hb?



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Hemoglobini su tetrameri sastavljeni od parova dviju različitih polipeptidnih podjedinica. Sastav podjedinica glavnih hemoglobina je α2β2 (HbA; normalan hemoglobin odraslih), α2γ2 (HbF; fetalni hemoglobin) i α2δ2 (HbA2; manji hemoglobin odraslih)

Ukupan broj aminokiselina u beta lancu i gama lancu je isti - 146. Veći afinitet HbF prema kisiku posljedica je prisutnosti serina (u gama lancu) umjesto histidina (u beta lancu), koji inhibira njegovo vezanje s 2,3-bisfosfoglicerinskom kiselinom.

Je li to jedina razlika, ili ima još takvih razlika u slijedu aminokiselina?


Evo parnog poravnanja sekvenci beta (HBB) i gama (HBG1) lanaca ljudskog hemoglobina:

HBB_HUMAN 1 VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLST 50 .|.|.|:|:.:|:||||||::.|||.||||||||||||||:||| :||: HBG1_HUMAN 1 GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSS 50 HBB_HUMAN 51 PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSS 50 HBB_HUMAN 51 PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVD|.:|| |||||||||| HBG1_HUMAN 51 ASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDP 100 HBB_HUMAN 101 ENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH 146 ||||:|:||:|:||:| :|| HBG1_HUMAN 101 ENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH 146

Možete vidjeti zamjenu H143S (ili S143H?), kao i mnoge druge.


Geni gama globina (HBG1 i HBG2) normalno su izraženi u fetalnoj jetri, slezeni i koštanoj srži. Dva gama lanca zajedno s dva alfa lanca čine fetalni hemoglobin (HbF) koji se normalno zamjenjuje hemoglobinom odraslih (HbA) u godini nakon rođenja. U nepatološkom stanju poznatom kao nasljedna perzistencija fetalnog hemoglobina (HPFH), ekspresija gama globina se nastavlja u odrasloj dobi. Također, u slučajevima beta-talasemije i srodnih stanja, proizvodnja gama lanca može se održati, vjerojatno kao mehanizam za kompenzaciju mutiranog beta-globina. Dvije vrste gama lanaca razlikuju se u ostatku 136 gdje se glicin nalazi u G-gama produktu (HBG2), a alanin u A-gama produktu (HBG1). Prvi je dominantan pri rođenju. Redoslijed gena u beta-globinskom klasteru je: 5' - epsilon – gama-G – gama-A – delta – beta - 3'. [4]

  1. ^ abcGRCh38: Ensembl izdanje 89: ENSG00000213934 - Ensembl, svibanj 2017.
  2. ^"Human PubMed Reference:". Nacionalni centar za informacije o biotehnologiji, Nacionalna medicinska knjižnica SAD-a.
  3. ^
  4. Higgs DR, Vickers MA, Wilkie AO, Pretorius IM, Jarman AP, Weatherall DJ (svibanj 1989.). "Pregled molekularne genetike klastera ljudskih alfa-globinskih gena". Krv. 73 (5): 1081–104. doi: 10.1182/krv.V73.5.1081.1081 . PMID2649166.
  5. ^
  6. "Entrez Gen: HBG1 hemoglobin, gama A".
  • Huisman TH, Kutlar F, Gu LH (1992). "Anomalije gama lanca i preuređenje gena gama-globina u novorođenčadi različitih populacija". Hemoglobin. 15 (5): 349–79. doi:10.3109/03630269108998857. PMID1802881.
  • Gelinas R, Yagi M, Endlich B, et al. (1985). "Sekvence G gama, A gama i beta gena grčkog (A gama) HPFH mutanta: dokaz za distalnu CCAAT box mutaciju u A gama genu". Prog. Clin. Biol. Rez. 191: 125–39. PMID2413469.
  • Giardina B, Messana I, Scatena R, Castagnola M (1995). "Višestruke funkcije hemoglobina". krit. vlč. Biochem. Mol. Biol. 30 (3): 165–96. doi:10.3109/10409239509085142. PMID7555018.
  • Anderson NL, Anderson NG (2003). "Proteom ljudske plazme: povijest, karakter i dijagnostički izgledi". Mol. stanica. Proteomika. 1 (11): 845–67. doi: 10.1074/mcp.R200007-MCP200 . PMID12488461.
  • Chang JC, Kan YW (1979). "beta 0 talasemija, glupa mutacija u čovjeka". Proc. Natl. Akad. Sci. SAD. 76 (6): 2886–9. doi:10.1073/pnas.76.6.2886. PMC383714 . PMID88735.
  • Saglio G, Ricco G, Mazza U, et al. (1979). "Ljudski T gama globinski lanac je varijanta A gama lanca (A gama Sardinija)". Proc. Natl. Akad. Sci. SAD. 76 (7): 3420–4. doi:10.1073/pnas.76.7.3420. PMC383837 . PMID291015.
  • Poon R, Kan YW, Boyer HW (1979). "Slijed 3'-nekodirajućih i susjednih kodirajućih regija ljudske gama-globinske mRNA". Nukleinske kiseline Res. 5 (12): 4625–30. PMC342777 . PMID318163.
  • Grifoni V, Kamuzora H, Lehmann H, Charlesworth D (1975). "Nova varijanta Hb: Hb F Sardinia gamma75(E19) izoleucin dovodi do treonina pronađenog u obitelji s Hb G Philadelphia, nedostatkom beta lanca i hemoglobinom sličnim Leporeu koji se ne razlikuje od Hb A2". Acta Haematol. 53 (6): 347–55. doi:10.1159/000208204. PMID808940.
  • Proudfoot NJ, Brownlee GG (1976). "3' nekodirajuće sekvence regije u eukariotskoj glasničkoj RNA". Priroda. 263 (5574): 211–4. doi:10.1038/263211a0. PMID822353. S2CID4211839.
  • Marotta CA, Forget BG, Cohne-Solal M, et al. (1977). "Ljudska beta-globinska glasnička RNA. I. Nukleotidne sekvence izvedene iz komplementarne RNA". J. Biol. Chem. 252 (14): 5019–31. PMID873928.
  • Frier JA, Perutz MF (1977). "Struktura ljudskog fetalnog deoksihemoglobina". J. Mol. Biol. 112 (1): 97–112. doi: 10.1016/S0022-2836(77)80158-7. PMID881729.
  • Ahern E, Holder W, Ahern V i sur. (1975). "Haemoglobin F Victoria Jubilee (alfa 2 A gama 2 80 Asp-Try)". Biochim. Biophys. Acta. 393 (1): 188–94. doi: 10.1016/0005-2795(75)90230-5. PMID1138921.
  • Waye JS, Cai SP, Eng B, et al. (1993). "Klinički tijek i molekularna karakterizacija spoja heterozigota za srpasti hemoglobin i hemoglobin Kenija". Am. J. Hematol. 41 (4): 289–91. doi:10.1002/ajh.2830410413. PMID1283810. S2CID35045351.
  • Bailey WJ, Hayasaka K, Skinner CG, et al. (1994). "Preispitivanje afričke hominoidne trihotomije s dodatnim sekvencama iz klastera beta-globina primata". Mol. Filogenet. Evol. 1 (2): 97–135. doi: 10.1016/1055-7903(92)90024-B. PMID1342932.
  • Gottardi E, Losekoot M, Fodde R, et al. (1992). "Brza identifikacija denaturirajućim gradijentom gel elektroforeze mutacija u promotorima gena gama-globina u HPFH tipa bez delecije". Br. J. Haematol. 80 (4): 533–8. doi:10.1111/j.1365-2141.1992.tb04569.x. PMID1374633. S2CID27249036.
  • Berry M, Grosveld F, Dillon N (1992). "Jedna točkasta mutacija je uzrok grčkog oblika nasljedne perzistencije fetalnog hemoglobina". Priroda. 358 (6386): 499–502. doi: 10.1038/358499a0. hdl: 1765/2476 . PMID1379347. S2CID4235661.
  • Loudianos G, Moi P, Lavinha J, et al. (1993). "Normalne sekvence gena delta-globina u sardinskoj nedelecijskoj delta beta-talasemiji". Hemoglobin. 16 (6): 503–9. doi:10.3109/03630269208993118. PMID1487421.
  • Fucharoen S, Shimizu K, Fukumaki Y (1990). "Novi C-T prijelaz unutar distalnog CCAAT motiva G gama-globinskog gena u japanskom HPFH: implikacija vezanja faktora u povišenoj ekspresiji fetalnog globina". Nukleinske kiseline Res. 18 (17): 5245–53. doi:10.1093/nar/18.17.5245. PMC332148 . PMID1698280.
  • Plašeska D, Kutlar F, Wilson JB, et al. (1991). "Hb F-Jiangsu, prva varijanta gama lanca sa supstitucijom valina----metionina: alfa 2A gama 2 134(H12)Val----Met". Hemoglobin. 14 (2): 177–83. doi:10.3109/03630269009046959. PMID1703137.
  • Pregled svih strukturnih informacija dostupnih u PDB-u za UniProt: P69891 (Hemoglobinska podjedinica gama-1) na PDBe-KB.

Ovaj članak vezan uz proteine ​​je začetak. Wikipediji možete pomoći tako da je proširite.


Epidemiologija

Otprilike 5 posto svjetske populacije ima globinsku varijantu, ali samo 1,7 posto ima obilježje alfa ili beta talasemije.2 Talasemija podjednako pogađa muškarce i žene i javlja se u otprilike 4,4 od svakih 10 000 živorođenih. Alfa talasemija se najčešće javlja kod osoba afričkog i jugoistočnog azijskog podrijetla, a beta talasemija je najčešća u osoba mediteranskog, afričkog i jugoistočnog azijskog podrijetla. Obilježje talasemije pogađa 5 do 30 posto osoba u tim etničkim skupinama.2

SORTIRAJ: KLJUČNE PREPORUKE ZA PRAKSU

Osobe s anemijom zbog talasemije ne bi trebale uzimati dodatke željeza osim ako imaju istovremeni nedostatak željeza.

Osobe s beta talasemijom major zahtijevaju periodične doživotne transfuzije krvi kako bi održale razinu hemoglobina više od 9,5 g po dL (95 g po L) i održale normalan rast.

Osobe s beta talasemijom major zahtijevaju kelacijsku terapiju zbog preopterećenja željezom.

Osobama s rizikom od rođenja djeteta s talasemijom treba ponuditi genetsko savjetovanje prije začeća.

A = dosljedni, kvalitetni dokazi usmjereni na pacijenta B = nedosljedni ili ograničeni kvalitetni dokazi usmjereni na pacijenta C = konsenzus, dokazi usmjereni na bolest, uobičajena praksa, stručno mišljenje ili niz slučajeva. Za informacije o SORT sustavu ocjenjivanja dokaza idite na https://www.aafp.org/afpsort.xml.

SORTIRAJ: KLJUČNE PREPORUKE ZA PRAKSU

Osobe s anemijom zbog talasemije ne bi smjele uzimati dodatke željeza osim ako imaju istovremeni nedostatak željeza.

Osobe s beta talasemijom major zahtijevaju periodične doživotne transfuzije krvi kako bi održale razinu hemoglobina više od 9,5 g po dL (95 g po L) i održale normalan rast.

Osobe s beta talasemijom major zahtijevaju kelacijsku terapiju zbog preopterećenja željezom.

Osobama s rizikom od rođenja djeteta s talasemijom treba ponuditi genetsko savjetovanje prije začeća.

A = dosljedni, kvalitetni dokazi usmjereni na pacijenta B = nedosljedni ili ograničene kvalitete orijentirani dokazi prema pacijentu C = konsenzus, dokazi usmjereni na bolest, uobičajena praksa, stručno mišljenje ili niz slučajeva. Za informacije o SORT sustavu ocjenjivanja dokaza idite na https://www.aafp.org/afpsort.xml.


Hemoglobin: normalne, visoke, niske razine i uzroci

Hemoglobin je proteinska molekula u crvenim krvnim stanicama koja prenosi kisik iz pluća u tjelesna tkiva i vraća ugljični dioksid iz tkiva natrag u pluća.

Hemoglobin se sastoji od četiri proteinske molekule (globulinski lanci) koje su međusobno povezane. Normalna molekula hemoglobina odrasle osobe (skraćeno Hgb ili Hb) sadrži dva lanca alfa-globulina i dva lanca beta-globulina. Kod fetusa i dojenčadi beta lanci nisu česti, a molekula hemoglobina se sastoji od dva alfa lanca i dva gama lanca. Kako dojenče raste, gama lanci se postupno zamjenjuju beta lancima, tvoreći strukturu hemoglobina odrasle osobe.

Svaki lanac globulina sadrži važan spoj porfirina koji sadrži željezo, nazvan hem. U spoj hema ugrađen je atom željeza koji je vitalan u transportu kisika i ugljičnog dioksida u našoj krvi. Željezo sadržano u hemoglobinu također je odgovorno za crvenu boju krvi.

Hemoglobin također igra važnu ulogu u održavanju oblika crvenih krvnih stanica. U svom prirodnom obliku, crvene krvne stanice su okrugle s uskim središtima nalik na krafnu bez rupe u sredini. Zbog toga abnormalna struktura hemoglobina može poremetiti oblik crvenih krvnih stanica i spriječiti njihovu funkciju i protok kroz krvne žile.

Simptomi anemije

Anemija je medicinsko stanje u kojem je broj crvenih krvnih stanica ili hemoglobin manji od normalnog. Simptomi anemije uključuju

  • Umor
  • Osjećaj lošeg zdravlja
  • Lupanje srca
  • Gubitak kose
  • Kratkoća daha

Kako se mjeri hemoglobin?

Hemoglobin se obično mjeri kao dio rutinskog testa kompletne krvne slike (CBC) iz uzorka krvi.

Postoji nekoliko metoda za mjerenje hemoglobina, od kojih većinu trenutno rade automatizirani strojevi dizajnirani za obavljanje različitih testova na krvi. Unutar stroja, crvene krvne stanice se razgrađuju kako bi se hemoglobin pretvorio u otopinu. Slobodni hemoglobin je izložen kemikaliji koja sadrži cijanid i koji se čvrsto veže s molekulom hemoglobina i stvara cijanomethemoglobin. Prosijavanjem svjetla kroz otopinu i mjerenjem količine svjetlosti koja se apsorbira (posebno na valnoj duljini od 540 nanometara), može se odrediti količina hemoglobina.

Što su normalan vrijednosti hemoglobina?

Razina hemoglobina izražava se kao količina hemoglobina u gramima (gm) po decilitru (dL) pune krvi, a decilitar je 100 mililitara.

Normalni rasponi hemoglobina ovise o dobi i, počevši od adolescencije, o spolu osobe. Normalni rasponi su:

  • Novorođenčad: 17 do 22 gm/dL
  • Jedan (1) tjedan starosti: 15 do 20 gm/dL
  • Jedan (1) mjesec starosti: 11 do 15 gm/dL
  • Djeca: 11 do 13 gm/dL
  • Odrasli mužjaci: 14 do 18 gm/dL
  • Odrasle žene: 12 do 16 gm/dL
  • Muškarci nakon srednje dobi: 12,4 do 14,9 gm/dL
  • Žene nakon srednje dobi: 11,7 do 13,8 gm/dL

Sve ove vrijednosti mogu se neznatno razlikovati između laboratorija. Neki laboratoriji ne prave razliku između vrijednosti hemoglobina u odrasloj dobi i vrijednosti hemoglobina "poslije srednje dobi". Trudnicama se savjetuje izbjegavanje i visoke i niske razine hemoglobina kako bi se izbjegao povećan rizik od mrtvorođenosti (visok hemoglobin &ndash iznad normalnog raspona) i prijevremenog poroda ili bebe niske porođajne težine (nizak hemoglobin &ndash ispod normalnog raspona).

Što znači a niska razina hemoglobina znači?

Niska razina hemoglobina se naziva anemija ili niska crvena krvna slika. Manji broj crvenih krvnih stanica od normalnog naziva se anemijom, a razina hemoglobina odražava taj broj. Mnogo je razloga (uzroka) za anemiju.

Neki od najčešćih uzroka anemije su:

  • gubitak krvi (traumatske ozljede, operacije, krvarenje, rak debelog crijeva ili čir na želucu),
  • nedostatak u ishrani (željezo, vitamin B12, folat),
  • problemi s koštanom srži (zamjena koštane srži rakom),
  • supresija sintezom crvenih krvnih stanica kemoterapijskim lijekovima, i
  • abnormalna struktura hemoglobina (anemija srpastih stanica ili talasemija).

PITANJE

Što znači a visoka razina hemoglobina znači?

Viša razina hemoglobina od normalne može se vidjeti kod ljudi koji žive na velikoj nadmorskoj visini i kod ljudi koji puše. Dehidracija uzrokuje lažno visok hemoglobin koji nestaje kada se uspostavi pravilna ravnoteža tekućine.


Beta talasemija

Talasemije su skupina genetskih (nasljednih) poremećaja krvi kojima je zajedničko jedno obilježje, defektna proizvodnja hemoglobina, proteina koji omogućuje crvenim krvnim stanicama da nose i isporučuju kisik. Postoji mnogo različitih mehanizama defektne sinteze hemoglobina, a time i mnogih vrsta talasemije.

Koji je najčešći tip talasemije?

Najpoznatija vrsta talasemije je beta talasemija. Uključuje smanjenu proizvodnju normalnog hemoglobina odraslih (Hb A), prevladavajućeg tipa hemoglobina od ubrzo nakon rođenja do smrti. (Sav hemoglobin se sastoji od dva dijela: hema i globina). Globinski dio Hb A ima 4 proteinska dijela koji se nazivaju polipeptidni lanci. Dva od ovih lanaca su identična i označeni su kao alfa lanci. Druga dva lanca su također identična jedan drugome, ali se razlikuju od alfa lanaca i nazivaju se beta lancima. U osoba s beta talasemijom, postoji smanjena ili odsutna proizvodnja beta globinskih lanaca.

Koja je razlika između male i velike talasemije?

Postoje dva oblika beta talasemije. To su mala talasemija i velika talasemija (koja se još naziva i Cooleyeva anemija).

Thalassemia minor: Osoba s talasemijom minor ima samo jednu kopiju gena beta talasemije (zajedno s jednim savršeno normalnim genom beta lanca). Za osobu se kaže da je heterozigotna za beta talasemiju.

Osobe s talasemijom minor imaju (najviše) blagu anemiju (blago sniženje razine hemoglobina u krvi). Ova situacija može vrlo nalikovati onoj s blagom anemijom zbog nedostatka željeza. Međutim, osobe s talasemijom minor imaju normalnu razinu željeza u krvi (osim ako im nedostaje željeza iz drugih razloga). Za talasemiju minor nije potrebno liječenje. Konkretno, željezo nije potrebno niti se savjetuje.

Thalassemia major (Cooleyjeva anemija): Dijete rođeno s talasemijom major ima dva gena za beta talasemiju i nema normalan gen za beta lanac. Dijete je homozigotno za beta talasemiju. To uzrokuje upečatljiv nedostatak u proizvodnji beta lanca i u proizvodnji Hb A. Thalassemia major je značajna bolest.

Kliničku sliku povezanu s talasemijom major prvi je opisao 1925. godine američki pedijatar Thomas Cooley. Otuda i naziv Cooley's anemia u njegovu čast.

Pri rođenju beba s talasemijom major čini se posve normalnom. To je zato što je prevladavajući hemoglobin pri rođenju još uvijek fetalni hemoglobin (HbF). HbF ima dva alfa lanca (kao Hb A) i dva gama lanca (za razliku od Hb A). Nema beta lanaca pa je beba pri rođenju zaštićena od učinaka talasemije velike.

Anemija se počinje razvijati u prvim mjesecima nakon rođenja. Progresivno postaje sve teže. Dojenče ne uspijeva (da raste normalno) i često ima problema s hranjenjem (zbog lakog umora od nedostatka kisika zbog duboke anemije), napadaja vrućice, proljeva i drugih crijevnih problema.

SLIDESHOW

Što je mediteranska anemija?

Gen za beta talasemiju nije ravnomjerno raspoređen među narodima. Relativno je češći, primjerice, kod ljudi talijanskog i grčkog podrijetla, a oboje su narodi s Mediterana. Zbog toga je talasemija velika nazvana mediteranska anemija.

Naziv talasemija skovali su na Sveučilištu Rochester u saveznoj državi New York patolog George Whipple dobitnik Nobelove nagrade i profesor pedijatrije William Bradford s grčkog thalassa za more i -emia, što znači krv. Talasemija znači "more u krvi". No za Grke je more bilo Mediteran, pa talasemija u krvi prenosi i ideju Mediterana.

Razlog što je gen za beta talasemiju relativno čest, na primjer, među ljudima talijanskog i grčkog podrijetla je taj što su dijelovi Italije i Grčke nekada bili puni malarije. Prisutnost thalassemia minor (poput obilježja srpastih stanica u Africi) pružila je zaštitu od malarije, te je stoga ovaj gen napredovao.

Koji je genetski obrazac nasljeđivanja beta talasemije?

Obrazac genetskog prijenosa beta talasemije (i bolesti srpastih stanica) dešifrirao je James V. Neel dok je bio na Sveučilištu u Rochesteru (a kasnije na Sveučilištu Michigan). Dr. Neel je prepoznao da roditelji djece s velikom talasemijom imaju malu talasemiju s jednim genom za beta talasemiju. Kada su ti roditelji imali djecu, imaju 25% šanse da će imati dijete s talasemijom major (s oba gena za beta talasemiju), 50% šanse da će imati djecu s talasemijom minor (sa samo jednim genom za beta talasemiju) i 25 % šanse za rođenje djeteta bez velike ili male talasemije (s oba gena za normalne beta lance). Ovaj oblik nasljeđivanja medicinski se naziva autosomno recesivni uzorak.


Alfa i beta talasemija i laboratorijski testovi

talasemija

Talasemija je vrsta poremećaja koji se nasljeđuje po krvi (prenosi se s roditelja na njihovu djecu). Ovo stanje utječe na količinu i vrstu hemoglobina koji proizvodi tijelo.

Hemoglobin (skraćeno Hgb ili Hb) je komponenta koja se nalazi u crvenim krvnim stanicama (skraćeno eritrociti). Crvene krvne stanice moraju ispravno funkcionirati jer prenose kisik u različite dijelove tijela. Hemoglobin je ogroman spoj, s različitim dijelovima kao što su:

  • Heme – Ovo je molekula sa željezom u središtu
  • Globini – Ovo je još jedan dio koji se sastoji od četiri proteinska lanca (svaki globin u lancu sadrži hemsku skupinu, koja sadrži jedan atom željeza.)

Ovisno o strukturi, globinski lanci su označeni kao delta, gama, beta ili alfa. Važno je napomenuti da nisu svi hemoglobini isti. Svaki je klasificiran ovisno o vrsti globinskog lanca. Također, važno je napomenuti da vrsta globinskog lanca igra veliku ulogu u sposobnosti hemoglobina da transportira kisik.

Normalne vrste hemoglobina uključuju:

  • Hemoglobin A – Ova vrsta Hb prevladava u odraslih i čini oko 95% -98% hemoglobina. Sadrži dva beta i dva alfa proteinska lanca.
  • Hemoglobin A2 – Ovaj tip čini oko 2% -3,5% Hgb koji se nalazi u odraslih. Ovaj tip također ima dva delta i dva alfa proteinska lanca.
  • Hemoglobin F – Ova vrsta Hgb čini 2% hemoglobina koji se nalazi u odraslih. Ovaj tip također ima dva gama i dva alfa proteinska lanca.

Jeste li znali da se hemoglobin F prvenstveno proizvodi u razvoju beba (fetusa), dok su u maternici? Proizvodnja Hb F smanjuje se na niske razine unutar prve godine nakon rođenja.

Osoba s talasemijom obično ima jednu ili više genetskih mutacija koje je naslijedila. Iz tog razloga smanjuje proizvodnju normalnog hemoglobina. U trenutku kada tijelo ne proizvodi dovoljno hemoglobina, crvena krvna zrnca neće normalno funkcionirati niti učinkovito dostavljati kisik tijelu. Ovaj problem može uzrokovati anemiju sa simptomima i znakovima, u rasponu od blage do teške. Sve ovisi o vrsti talasemije koju netko ima.

Znakovi i simptomi mogu uključivati:

Postoje četiri gena u našoj DNK kada je u pitanju hemoglobin, koji kodiraju lance gama-globina, dva gena delta, dva gena beta i alfa-globinske lance. Budući da svatko nasljeđuje skup kromosoma od oba roditelja, svatko dobiva dva gena za alfa globulin i gen za beta globulin. Iz tog razloga, osoba može naslijediti mutaciju u genima beta ili alfa-globina.

Proizvodnja male količine globinskog lanca uzrokovana je mutacijom u jednom ili nekoliko globinskih gena. Naravno, kada se to dogodi, treba očekivati ​​neravnotežu alfa i beta lanaca, što rezultira neuobičajenim oblikom hemoglobina ili povećanim brojem minornog hemoglobina poput Hgb F ili Hgb A2. Ove talasemije se općenito klasificiraju prema vrsti globinskog lanca čija je sinteza niska.

Na primjer, uobičajeno stanje povezano s alfa lancem poznato je kao alfa talasemija. Ozbiljnost ovog stanja uvelike ovisi o broju zahvaćenih gena. Druge vrste mutacija, kao što su geni globinskog lanca koji kodiraju, mogu rezultirati strukturno promijenjenim globinom. To može rezultirati hemoglobinom S, koji uzrokuje srpaste stanice. Ovo nasljedno stanje, koje uzrokuje proizvodnju abnormalnih molekula hemoglobina, u potpunosti je opisano u članku koji govori o abnormalnostima hemoglobina. I abnormalnosti hemoglobina i talasemija poznate su kao hemoglobinopatije.

Alfa talasemija

Alfa talasemija je rezultat ili mutacije ili iscrpljivanja jedne ili više kopija genetskog faktora alfa-globina. Važno je napomenuti da se proizvodnja alfa-globina smanjuje zbog mutacije. Što je veći broj zahvaćenih gena, tijelo će proizvoditi nizak alfa-globin. Sve četiri vrste alfa talasemije klasificirane su na temelju broja zahvaćenih gena. Oni uključuju:

Oni koji imaju mutaciju(e) u samo jednom alfa-globinskom genu jednostavno su tihi nositelji. Takva osoba će imati normalnu razinu hemoglobina, kao i profil crvenih krvnih zrnaca. Međutim, oni i dalje mogu prenijeti zahvaćeni gen svojoj djeci. Takva osoba također neće osjetiti nikakve znakove ili simptome stanja, a oni se identificiraju tek nakon rođenja djeteta s talasemijom. Jedini način da saznate jeste li nositelj je putem DNK analize (provjerite testove talasemije).

Osoba sa osobinama alfa talasemije imat će crvena krvna zrnca koja su hipokromna (blijedija) i mikrocitna (manja) od normalne osobe. Crvena krvna stanica će također imati smanjen srednji korpuskularni volumen (MCV), što je mjera prosječne veličine jednog eritrocita. Osoba će također imati blagu kroničnu anemiju. U većini slučajeva, osoba s obilježjem alfa talasemije neće iskusiti nikakve druge pjesmice i povremeno nedostaju simptomi.

Ovaj oblik anemije ne reagira dobro na dodatke željeza. Osobinu alfa talasemije treba postići uklanjanjem drugih uzroka mikrocitne anemije. Potvrdno testiranje putem DNK analize je dostupno, ali se uglavnom ne radi.

S ovim stanjem, budući da postoji veliko smanjenje alfa-globinskog lanca, broj beta lanaca postaje visok. Ova desetka se spaja u skupinu od 4 beta lanca, poznata kao Hemoglobin H., što postaje vidljivo u crvenim krvnim stanicama na posebno obojenom razmazu krvi. Hgb H bolest može uzrokovati umjerenu do tešku anemiju, što rezultira zdravstvenim problemima poput umora, deformiteta kostiju i povećane slezene. Njegovi simptomi ili znakovi se jako razlikuju. Neki ljudi su asimptomatski, dok drugi obolijevaju od ozbiljne anemije i trebaju stalnu liječničku skrb. Ovo stanje se uglavnom nalazi kod ljudi mediteranskog podrijetla ili jugozapadne Azije.

Hydrops Fetalis je najteži oblik alfa talasemije. S ovim stanjem tijelo ne proizvodi alfa globin, što znači da tijelo nema normalan hemoglobin. Većina nerođene djece zahvaćene alfa talasemijom tijekom trudnoće postaje anemična. Često imaju veća srca i jetra. Također zadržavaju hidropičnu (pretjeranu tekućinu). Dijagnoza trudnoće često se provodi tijekom posljednjih mjeseci trudnoće.

U opasnosti su i trudnice. Istraživanja pokazuju da su majke pod visokim rizikom od dobivanja toksemije (visok krvni tlak, proteini u mokraći, otečeni gležnjevi i stopala). Majka također može razviti teško krvarenje (postporođajno krvarenje). Većina fetusa s teškim slučajem alfa talasemije često je pobačena, mrtvorođena ili umire ubrzo nakon rođenja. Rijetko je da dijete s alfa talasemijom major preživi kroz opsežnu medicinsku skrb i transfuziju krvi utero. Ovo stanje je najčešće kod osoba mediteranskog podrijetla, Afrikanaca, Indijaca, Bliskog istoka, Južne Kine i Jugoistočne Azije.

Beta talasemija je stanje koje je rezultat mutacije jednog ili više gena za beta-globin. Identificirano je više od 250 mutacija. Međutim, samo oko 20 je najčešćih. Ozbiljnost anemije kao posljedica beta-talasemije uvelike ovisi o samoj mutaciji i stupnju proizvodnje beta. Različite vrste beta-talasemije uključuju:

Osoba s ovim stanjem imat će jedan gen s mutacijom, a drugi normalan. To uzrokuje blago smanjenje proizvodnje beta-globina. U većini slučajeva ovo stanje ne donosi nikakve zdravstvene probleme osim abnormalnih malih crvenih krvnih stanica i pozitivne blage anemije koja ne reagira na dodatke željeza. Zapamtite, ovo stanje se može naslijediti.

Osoba s ovim stanjem ima dva abnormalna gena, što uzrokuje umjereno do ozbiljno smanjenje proizvodnje beta-globina. Takva osoba može razviti simptome kasnije u životu od onih kod talasemije major, a simptomi su blagi. Takva osoba rijetko zahtijeva liječenje transfuzijom krvi. Ozbiljnost zdravstvenih problema i anemije koju će osoba dobiti općenito će ovisiti o vrsti mutacije. Razdjelnica između thalassemia major i thalassemia intermedia je stupanj anemije, učestalost i broj potrebnih transfuzija krvi. Međutim, transfuzija krvi potrebna je redovito osobi s talasemijom intermedijom.

Ovo je najteže stanje beta-talasemije. Osoba koja pati od ovog stanja ima dva abnormalna gena, što uzrokuje ili ozbiljno smanjenje ili nedostatak proizvodnje beta-globina. To sprječava proizvodnju visokog broja normalnog hemoglobina A. Ovo stanje će se pojaviti unutar prve dvije godine života i uglavnom dovodi do stanja opasnih po život. Također utječe na rast i abnormalnosti skeleta tijekom dojenačke dobi. Ova stanja zahtijevaju redovite transfuzije krvi i značajnu stalnu medicinsku skrb.

S vremenom česte transfuzije uzrokuju prekomjernu količinu željeza u tijelu. Ako se ne liječi, prekomjerno željezo može se taložiti u srcu, jetri i drugim vitalnim tjelesnim organima, što može dovesti do zatajenja organa. Iz tog razloga, osoba koja je podvrgnuta transfuziji trebat će terapiju kelacijom kako bi se smanjilo preopterećenje željezom.

Ovo stanje se obično nalazi kod potomaka Afrikanaca, Mediterana i jugoistočne Azije u SAD-u. To je zato što je povezana s pojavom malarije u tim područjima jer talasemija može povećati toleranciju malarije. Stoga je u tim područjima incidencija talasemije malarije čak 10%.

Druge vrste talasemije nastaju kada je gen za beta-talasemiju naslijeđen u kombinaciji s genom za hemoglobin. Najvažniji od njih su:

Ovo je jedna od najčešćih varijacija hemoglobina. Ovo stanje se nalazi posebno kod ljudi iz afričkih i jugoistočnih azijskih potomaka. Stoga, ako osoba naslijedi jedan gen za beta-talasemiju i jedan gen Hb E, kombinacija proizvodi Hb E-beta talasemiju, koja uzrokuje umjerenu do tešku anemiju, koja je poput beta-talasemije intermedia.

Ovo je dobro poznato stanje varijanti hemoglobina. Oni koji naslijede jedan gen beta-talasemije i jedan gen Hb S rezultiraju Hb S-beta talasemijom. Kod ovog stanja, ozbiljnost ovisi o količini beta-globina koju proizvodi beta gen. Ako se beta-globin ne proizvodi, kliničke slike su poput bolesti srpastih stanica.

Testovi i dijagnoza

Za otkrivanje i dijagnosticiranje talasemije može se koristiti nekoliko laboratorijskih testova:

Ovaj oblik dijagnoze je procjena stanica u krvi. Osim ostalog, CBC određuje broj crvenih krvnih stanica i količinu hemoglobina u njima. Ova dijagnoza se koristi za procjenu oblika i veličine crvenih krvnih stanica koje su dostupne i prijavljene kao indeksi crvenih krvnih stanica. Dijagnoza će uključivati ​​MCV (srednji korpuskularni volumen) i mjerenje crvenih krvnih stanica. Prvi pokazatelj talasemije je nizak MCV. Kako? Pa, ako je nedostatak željeza isključen, ali je MCV još uvijek nizak, tada će liječnik sljedeće razmotriti talasemiju.

2. Razmaz krvi (slično poznat kao periferni razmaz i ručni diferencijal)

Ovim laboratorijskim testom stručnjak će pod mikroskopom pregledati tanak sloj krvi koji je tretiran posebnom mrljom. Odatle će stručnjak razmotriti broj i vrste trombocita, crvenih krvnih stanica i bijelih krvnih stanica kako bi vidio jesu li normalne i zrele. Važno je napomenuti da će se kod osobe s talasemijom crvena krvna zrnca činiti manjim nego inače. Također je važno zapamtiti da crvene stanice također mogu:

  • anizocitoza i poikilocitoza (razlikuju se po veličini i obliku)
  • hipokromno (izgleda bljeđe od normalnog)
  • imaju neravnomjernu raspodjelu hemoglobina (stvaraju stanice koje izgledaju poput bikovog oka)
  • imati jezgru (stanice su normalne, zrele, ali nemaju jezgru)

Što je veći postotak za koje se utvrdi da su stanice abnormalne, to su veće šanse da osoba ima poremećaj, a time i da stanice izgube sposobnost cirkulacije kisika.

Ovaj oblik dijagnoze ili testa može uključivati ​​feritin, željezo, UIBC (nezasićeni kapacitet vezanja željeza), postotak zasićenja transferina i TIBC (ukupni kapacitet vezanja željeza). Ova dijagnoza mjeri sposobnost tijela da skladišti i koristi željezo. Ovaj test je važan jer pomaže utvrditi je li nedostatak željeza osnovni uzrok anemije. S ovim se testom može provesti jedan ili više testova jednostavno za praćenje stupnja preopterećenja željezom kod osobe s talasemijom.

Često se anemija zbog nedostatka željeza miješa s alfa talasemijom jer obje imaju slične karakteristike stanica. Međutim, mudro je napomenuti da se ne očekuje niska razina željeza kada je nekome dijagnosticirana talasemija. Kao takva, osoba s alfa talasemijom neće imati koristi od terapije željezom, a infarkt može uzrokovati otkaz glavnih tjelesnih organa zbog preopterećenja željezom.

Za razlikovanje beta-talasemije minor od trovanja olovom ili manjka željeza: može biti potreban eritrocitni porfirinski test. A person will have normal porphyrin levels even if they have beta-thalassemia, but those with either lead poisoning or iron deficiency will have an elevated porphyrin reading.

4. Hemoglobin Electrophoresis (Hemoglobinopathy (Hb) Evaluation)

This test aims to evaluate the kind, and the relative number of hemoglobin is present in the red blood cells. Hb A (Hemoglobin A) contains both the beta and alpha-globin, and it is a type of hemoglobin, which normally makes up about 97% of the hemoglobin in adults. Hemoglobin F usually makes up less than 2%, while Hb A2 (hemoglobin A2) usually takes up about 3% of hemoglobin in adults.

People with beta-thalassemia major often have larger percentages of Hgb F. That is because beta-thalassemia affects the balance of alpha and beta hemoglobin chain formation greatly. It causes an increase in minor hemoglobin components. Also, remember that a person with beta-thalassemia minor often has a high number of Hgb A2. Hb S is dominant in persons with sickle cell disease.

This test is important and helps identify and confirm the mutation in beta and alpha globin-producing genes. This test is not routinely done but can be used to aid thalassemia diagnosis, as well as determine carrier status if indicated.

The hemoglobin beta gene may be sequenced or analyzed to confirm the presence of mutations that may cause beta-thalassemia. Remember, there are more than 250 mutations that have been associated with beta-thalassemia, even though some do not come with signs or symptoms. On the other hand, some decrease the amount of beta-globin production while others prevent its production. The confirmation or discovery of those mutations is what confirms the diagnosis.

The main molecular test available for alpha thalassemia helps confirm common mutations such as deletions. Remember, everyone has two copies of these genes known as alleles. One of the functions of alleles is governing the production of alpha-globin. Therefore, if mutation leads to functional loss of either one or more alpha genes, alpha thalassemia will occur.

Because thalassemia is a condition that is passed down the generation, family education is wise so as they can evaluate or carry out studies to identify the types of mutations found within the family if found necessary by a HealthCare professional.

Amniotic fluid genetic testing is used in rare cases or situations if found a fetus is at risk for thalassemia. This testing is crucial, especially when both parents are carriers of a mutation that puts the infants at risk. In a nutshell, this test often takes place if the case is severe.


BETA-THALASSEMIA CARRIER IDENTIFICATION

The typical phenotype of the beta-thalassemia trait, essentially characterized by reduced MCV, MCH, and increased HbA2, may be modified by several coinherited genetic factor, which may cause problems in carrier identification (Table 3).

Coinheritance of heterozygous beta-thalassemia and alpha-thalassemia may raise the MCV and the MCH, high enough to determine normal values at least in some of these double heterozygotes. This may occur as a result of either a deletion of two alpha globin structural genes or as a nondeletion lesion affecting the major alpha globin gene (the two functional alpha genes, denominated as alphal and alpha2, have a relative expression of 1:3). Fortunately, these carriers may be easily identified for their high HbA2 razine. 93,94

Elevation of HbA2 is the most important feature in the detection of heterozygous beta-thalassemia, but a substantial group of beta-thalassemia heterozygotes may have normal HbA2. The first mechanism to account for the abnormally low HbA2 levels in a beta-thalassemia carrier is the presence of a specific mild beta-thalassemia mutation, such as the beta + IVS-I nt 6 mutation. 95 A second common mechanism is the coinheritance of heterozygous beta-thalassemia and delta-thalassemia. The decreased output of the delta globin chains may result in normalization of HbA2 razine. 96,97 Also, gammadeltabeta- and deltabeta-thalassemia carriers have normal HbA2. However, all these normal-HbA2 atypical heterozygotes have low MCV and MCH. Because of this phenotype, normal HbA2 beta-thalassemia heterozygotes should be differentiated from alpha-thalassemia heterozygotes by globin chain synthesis analysis and/or by alpha, beta, and delta globin gene analysis. Deltabeta-thalassemia, in addition, may easily be defined by the variable but markedly increased HbF.

Another major problem in carrier screening is the identification of silent beta-thalassemia or the triple or quadruple alpha globin gene arrangement, both of which may lead to the production of intermediate forms of beta-thalassemia by interacting with typical heterozygous beta-thalassemia. Silent beta-thalassemias are characterized by normal MCV and MCH values and normal HbA2 and by the fact that they are defined only by the slight imbalance in the alpha/nonalpha globin synthesis.

Nevertheless, on examining the hematological features of these carriers, one may find borderline HbA2 or MCV and MCH values, which may alert for the presence of atypical beta-thalassemia, thus requiring further studies (globin chain synthesis or gene analysis). The most common silent beta-thalassemia is the beta + −101 C→T mutation others are very rare. 98 The triple-quadruple alpha globin gene arrangement may show a slight imbalance of alpha/nonalpha chain synthesis or, more commonly, may be completely silent. An extreme, although rare, instance of thalassemia gene combination, which may result in carrier identification, is the coinheritance of alpha, delta, and beta-thalassemia, which may lead to a completely silent phenotype. 99

Carrier detection procedure

Several procedures have been proposed for beta-thalassemia carrier screening. 100 The cheapest and simplest is based on MCV and MCH determination, followed by HbA2 quantitation for subjects showing microcytosis (low MCV) and reduced Hb content per red blood cell (low MCH). However, because with this procedure a considerable proportion of double heterozygotes for beta- and alpha-thalassemia may be missed (these are found in many populations, such as Sardinians, where both disorders are common), it can only be used in populations with a low frequency of alpha-thalassemia. At our center in Cagliari, in the first set of examinations, we include MCV and MCH determination and Hb chromatography by HPLC, which can quantitate HbA2 and HbF and can detect the most common Hb variants (HbS, HbC, and HbE) that may result in a Hb disorder by interacting with beta-thalassemia (Fig. 4). It should be stated that HPLC is also capable of detecting Hb Knossos, a mild beta-thalassemia allele, which is not identified by using common procedures for Hb analysis. In the presence of low MCV and MCH and elevated HbA2 levels, a diagnosis of heterozygous beta-thalassemia is made. A phenotype characterized by microcytosis, hypochromia, normal-borderline HbA2, and normal HbF may result from iron deficiency, alpha-thalassemia, gammadeltabeta-thalassemia, beta + delta-thalassemia, or mild beta-thalassemia. After excluding iron deficiency through appropriate studies (red blood cell, zinc protoporphyrin determination, and transferrin saturation), the different thalassemia determinants leading to this phenotype are discriminated by globin chain synthesis analysis and eventually by alpha, beta, and delta globin gene analysis. 100 In the presence of normal MCV and borderline HbA2 levels, we are inclined to suspect the presence of a silent mutation or the triple or quadruple alpha globin gene arrangement and, therefore, proceed directly to alpha- and beta globin gene analysis, because the alpha/beta globin chain synthesis ratio could also be normal. 101 Definition of the type of thalassemias in these carriers is solely recommended when they mate with a carrier of a typically high HbA2 beta-thalassemia or an undetermined type of thalassemia. In those rare cases showing normal or low MCV-MCH, normal or reduced HbA2 levels, and high HbF, we suspect the presence of deltabeta-thalassemia, which should be differentiated from HPFH. This distinction is performed by globin chain synthesis analysis (normal in HPFH and unbalanced in deltabeta-thalassemia) or beta-cluster gene analysis or both.

Flowchart for thalassemia carrier identification.

Molecular diagnosis of modifying genes

Molecular diagnosis is carried out in patients affected by homozygous beta-thalassemia for defining the genotype, which may be useful for predicting the severity of the disease, and in carriers identified by hematological analysis.

The procedures available to detect the beta-thalassemia mutation have been already described. 23,24 As previously mentioned, delta globin gene analysis may be necessary to define double heterozygotes for delta- and beta-thalassemia that may be mistaken for alpha-thalassemia trait. The suspicion of interacting delta-thalassemia may arise when borderline HbA2 levels are found or when family studies show segregating delta-thalassemia (characterized by normal MCV-MCH and low HbA2) and beta-thalassemia. However, identification of delta and beta double heterozygotes may be accomplished by globin chain synthesis analysis and/or alpha, beta, and delta globin gene analysis. 101,102

Definition of the delta-thalassemia mutation may be carried out using one of the previously mentioned PCR-based methods. As in beta-thalassemia, also in delta-thalassemia, each population at risk has its own spectrum of common delta-thalassemia mutations that may be defined through a limited number of specific primers/probes. In Sardinians, for instance, few delta-thalassemia mutations have been so far detected. The list of delta-thalassemia mutations is available at the repository of the human beta and delta globin gene mutation. Although most of the delta-thalassemia determinants are in trans (on opposite chromosomes) to beta-thalassemia, some have also been detected in cis (on the same chromosome). 103

Definition of the alpha globin gene arrangement may be performed to discriminate between heterozygosity for alpha-thalassemia and double heterozygosity for delta- and beta-thalassemia or gammadeltabeta-thalassemia. This analysis could also be useful in defining coinherited alpha-thalassemia in homozygous beta-thalassemia, which may lead to the prediction of a mild clinical condition. Deletion alpha 0 - or alpha + -thalassemias are detected by PCR using two primers flanking the deletion breakpoint, which amplify a DNA segment only in presence of specific deletions. 104 Nondeletion alpha-thalassemia may be detected by restriction endonuclease analysis or allelic oligonucleotide specific probes on selectively amplified alpha1 and alpha2 globin genes. Alpha globin gene triplication and quadruplication may be detected by the MPLA procedure.

Definition of coinherited HPFH determinants can be useful in predicting the severity of the phenotype of an affected fetus. As mentioned above, in fact, on increasing the gamma chain output, coinherited HPFH with homozygous beta-thalassemia may lead to a milder phenotype. The presence of high HbF in the parents may lead to the suspicion of double heterozygosity for beta-thalassemia and HPFH. The 196 C→T in the A-gamma gene and −158 C→T in the G-gamma gene mutations have been proved to be capable of ameliorating the clinical phenotype of homozygous beta-thalassemia. The HPFH determinants may easily be detected through restriction endonuclease or dot blot analysis with oligonucleotide-specific probes on PCR-amplified DNA. Furthermore, definition of the polymorphisms at the BCL11A i HBS1L-MYB region may lead to predict the development of a specific mild phenotype.

If targeted mutation analysis fails to detect the mutation, mutation scanning or sequence analysis can be used to detect mutations in the HBB coding region (mutations in the noncoding region would not be detected by this analysis). Sensitivity of both mutation scanning and sequence analysis is 99%.

Deletions of variable extent of the beta gene or of the HBB cluster that result in beta-thalassemia or in the complex beta-thalassemias, called gammadeltabeta-thalassemia and deltabeta-thalassemia, are rare causes of beta-thalassemia and testing that deletions is available clinically by using MPLA.


Hemoglobin structure

Heme is an iron-porphyrin compound composed of Porphyrins and iron, P orphyrins are cyclic compounds derived from the porphin nucleus made of 4 pyrrole rings linked by 4 methenyl bridges (-CH=) labelled α, β, γ, and δ. The porphyrins found in nature are compounds in which side chains are substituted for the hydrogen atoms in the porphin nucleus. These are different types of porphyrins. Only types I and III occur in nature:

Type I isomer: The substituent groups attached to the 4 pyrrole rings are symmetrically arranged such as (AP.AP.AP.AP). Type III isomer: The substituent groups attached to the 4 th pyrrole ring are arranged in the reverse order, e.g. (AP, AP, AP, PA). The biologically important porphyrin in heme and cytochrome are type III isomers.

Iron is present in the ferrous state (Fe ++ ) and is linked to 4 nitrogen atoms of 4 pyrrole rings. Also, there are 2 additional bonds called 5 th and 6 th coordination bonds. These two bonds are located on each side of the heme plane (perpendicular to the heme plane).

Hemoglobin structure

The 5 th position is linked to the nitrogen atom of the imidazole ring of proximal histidine. while the 6 th position is bound to oxygen in HbO2 and empty in deoxyhemoglobin (Hb) (unoccupied). The 4 pyrrole rings are attached to side chains called methyl, Vinyl, methyl, Vinyl, methyl, propionyl, propionyl, methyl. (M, V, M, V, M, P, P, M).. The transport of O2 is based on a physical interaction between molecular O2 and iron of heme to provide reversible association.

Globin (protein part or apoprotein) is a simple protein (histone) which is characterized by its high content of histidine and lysine, Globin is composed of four polypeptide chains 2α & 2β chains, The α-chain contains 141 amino acids & β-chain contains 146 amino acids.

Each β-polypeptide chain is folded into 8 right-handed termed A-H starting from NH2-terminal, while α-subunit is folded into 7α-helices. The ratio of heme to globin is 4: 1. So, each heme moiety is linked to one peptide chain.

The myoglobin-hemoglobin family of proteins has produced a way in which Fe ++ can be bounded to the proteins so as to produce an O2 binding site. Hemoglobin protects the O2 binding Fe ++ from irreversible oxidation by providing environments in which the first step of an oxidation reaction ( the binding of oxygen) is permitted, but the final step (oxidation) is blocked.

Types of normal hemoglobin

Adult hemoglobin. There are 2 types of HbA1 and HbA2. Major adult hemoglobin: Hb A12 β2) contains 2 alpha chains and 2 beta chains. This hemoglobin A1 constitutes 95-97% of the total hemoglobin. Minor adult hemoglobin: Hb A22 δ2) contains 2 α-chains and 2 δ-chains. Hb A2 forms about 2-4% of total hemoglobin. In the δ-chains, there is more than one amino acid different than those in β-chains. npr. arginine residue at the position 16 instead of glycine which is normally present in the beta chain.

Glycosylated hemoglobin (Hb A1c) is a modified form of hemoglobin similar to hemoglobin A1 but it contains glucose linked to ε amino group present on lysyl residues and at the NH2-terminal ends. The reaction is non-enzymatic and its rate depends on the concentration of glucose.

It is present in normal value 5% of the total hemoglobin. This percentage is increased in prediabetic and diabetic patients up to 8-14 %. Thus, glycohemoglobin gives an idea about the blood glucose level during the last three months and is useful in the assessment of diabetic control.


Sickle hemoglobin (HbS) allele and sickle cell disease: a HuGE review

Sickle cell disease is caused by a variant of the beta-globin gene called sickle hemoglobin (Hb S). Inherited autosomal recessively, either two copies of Hb S or one copy of Hb S plus another beta-globin variant (such as Hb C) are required for disease expression. Hb S carriers are protected from malaria infection, and this protection probably led to the high frequency of Hb S in individuals of African and Mediterranean ancestry. Despite this advantage, individuals with sickle cell disease exhibit significant morbidity and mortality. Symptoms include chronic anemia, acute chest syndrome, stroke, splenic and renal dysfunction, pain crises, and susceptibility to bacterial infections. Pediatric mortality is primarily due to bacterial infection and stroke. In adults, specific causes of mortality are more varied, but individuals with more symptomatic disease may exhibit early mortality. Disease expression is variable and is modified by several factors, the most influential being genotype. Other factors include beta-globin cluster haplotypes, alpha-globin gene number, and fetal hemoglobin expression. In recent years, newborn screening, better medical care, parent education, and penicillin prophylaxis have successfully reduced morbidity and mortality due to Hb S.


Gledaj video: Hemoglobin (Kolovoz 2022).